>ENSANGP00000013359 gnl|CDD|22690 smart00147, RasGEF, Guanine nucleotide exchange fa... 24 0.30 gnl|CDD|3945 smart00577, CPDc, catalytic domain of ctd-like phos... 20 3.3 gnl|CDD|22681 smart00103, ALBUMIN, serum albumin; . 20 4.4 gnl|CDD|24307 smart00608, ACR, ADAM Cysteine-Rich Domain; . 20 5.6 gnl|CDD|14899 smart00115, CASc, Caspase, interleukin-1 beta conv... 19 6.7 ==> gnl|CDD|22690 smart00147, RasGEF, Guanine nucleotide exchange factor for Ras-like small GTPases; . Length = 242 Score = 23.7 bits (51), Expect = 0.30 Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 14/54 (25%) Query: 114 DRVRAVAHTVHDARVC--------------ALQSLPERQSESDWQRLSHPLVRL 153 DR ++ + A+ C AL S P + + W++L +L Sbjct: 73 DRAELLSKFIQVAKHCRELNNFNSLMAIVSALSSSPISRLKKTWEKLPSKYKKL 126 ==> gnl|CDD|3945 smart00577, CPDc, catalytic domain of ctd-like phosphatases; . Length = 149 Score = 20.2 bits (42), Expect = 3.3 Identities = 8/32 (25%), Positives = 14/32 (43%) Query: 48 GKHDLSTELLARADRRTRLVSAAGNVLLLQPD 79 GK+ LL R R ++ + + L P+ Sbjct: 103 GKYVKDLSLLNRDLSRVIIIDDSPDSWPLHPE 134 ==> gnl|CDD|22681 smart00103, ALBUMIN, serum albumin; . Length = 188 Score = 19.9 bits (41), Expect = 4.4 Identities = 7/20 (35%), Positives = 10/20 (50%) Query: 27 AQSVPSVPGAPVEELSRDVL 46 +Q VP V +L +DV Sbjct: 33 SQKVPQASFEEVVKLVKDVT 52 ==> gnl|CDD|24307 smart00608, ACR, ADAM Cysteine-Rich Domain; . Length = 139 Score = 19.5 bits (40), Expect = 5.6 Identities = 5/8 (62%), Positives = 5/8 (62%) Query: 42 SRDVLCGK 49 DV CGK Sbjct: 67 PEDVKCGK 74 ==> gnl|CDD|14899 smart00115, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues. . Length = 241 Score = 19.4 bits (40), Expect = 6.7 Identities = 7/20 (35%), Positives = 9/20 (45%) Query: 120 AHTVHDARVCALQSLPERQS 139 H+ D+ VC L S E Sbjct: 70 EHSDSDSFVCVLLSHGEEGG 89